Looking for 19th Century or similar products?
This site's goal is to match you with the largest selection of 19th Century in an easy to use one stop shop to help you find exactly what you're looking for.
This site showcases a large assortment of 19th Century, listing items such as Victorian Antique, Antique Wooden, Fishing Net, 19th, and much, much more.
Browse our vast collection of 19th Century, or do a quick search for a particular type of 19th Century using the search box. Our site has access to a huge selection of 19th Century listings from merchants online, so this site may have what you're trying to find!
If you are looking for 19th Century for sale then you're in the perfect place. At Rare Antiques For Sale Online we have a large variety of 19th Century available.
Shop 19th Century now!
table pc desk 12m laptop gaming study office home writing workstation computer. AUTOMOTO PRODUCTComputer Desk Writing Study Gaming PC Laptop Table Workstation Home Office 1.2M ...
Vintage Wrangler Blue Bell Denim Jeans Size 38. The Length Was Cut Off Measures Waist 38" Length 24" Rise 13.5" No Holes, A Few Small Stins(see Photos) Payment Due Within 3 Days
Sold by *lonelystar* in Van Nuys...
boat building plain x cloth fiberglass 3 long 60andquotw weave andamp repairs 10oz 4 yards. FIBERGLASS CLOTH STYLE 750060 Inches 5 Feet WideBy3 Yards 9 Feet Continuous LengthAlso Available In 5 Yards Cut Length httpswww..comitm22349562115710 Yards Cut Length httpswww..comitm3125855...
advertising portage wisconsin home radio 3 and service tv cablecord tag. Up for Buy it NowBest Offer isHome Radio and TV Service Portage Wisconsin CableCord Advertising TagWe ship USPS First Class Package with Tracking using quality packaging materials to protect your item.Dont ...
fishshrimpspratskeelankeeraminmaldives tunaqueen fish dried quality best. Best Quality Dry Fish Stole Dried Seafood SundriedMeals Well Cleaned ampamp SaltedItem DescriptionWhat is the importance of eating fishEating fish is an important source of omega3fatty acids. These ess...
Hp Proliant Dl380 Gen10 8b Server 2x 3.00ghz Gold 6136 P408i-a Wholesale- Custom.
Sold by digitalmind2000 in New Hudson...
Condition As Found, In Fair Condition. It Is Important To Affirm Our Position As Wholesale Art Dealers And Thatw E Are Not Authorized To Authenticate Artwork. We Adhere To E-bay. Inscribed By Artist Around Base With Date.
Sold by emperors_treasury in New York...
Th Century To The 20. Th Century. We Specialise In Finding, Restoring Very Fine Luxury Antique Leather Seating, Along With Every Single Other Type Of Antique Ranging From The 16.
Sold by royal-house-antiques in PULBOROUGH...
Ty Beanie Babies Retired Erin Bear Irish Green Shamrock Rare Collectible 1997.
Sold by mam511111 in West Sacramento...
Replaces Oe Number 88964168 Number Of Lugs 5 Lugs. Interchange Part Number 513179, 88964168 Prop 65 Warning Warning This Product Can Expose You To Chemicals Including Lead And Mineral Oils, Which Are Known To The State Of California To Cause Cancer And Birth Defects Or Other Reproductive Harm.
Sold by carparts in La Salle...
Fantastic Ultra Rare Moxie Butler Standing Ashtray Piece. Featured Is hitchy Moxies Butler Mascot. There Would Have Been A Base And An Arm Holding Out The Actual Ashtray. Double Sided And Hand Painted. These Are Exceedingly Hard To Find. There Is A Small Ring In The Top So That It Can Be Hung As A Sign. It Appears Someone Had Put Small Brackets On The Edge Of This Piece. Possibly To Use It As A Door Push. 31 Long. Fresh From The Estate Of A Life Long Professional Estate Clean Out Guy. This Will Be A Very Neat Cherry On The Top Of A Good Moxiesodasign Collection. I Also Have A Good Moxie Crate For Sale In A Separate Listing. Thanks
Sold by riverwalker83 in East Boston...
willabee pittsburgh official ward 1982 nfl year 50th steelers football patch. OFFICIAL NFL FOOTBALL CLOTH EMBROIDERED PATCH FROM THE NFL ANNIVERSARY COLLECTION PRODUCED BY WILLABEE ampamp WARD. PATCH IS SEALED IN PLASTIC ON ORIGINAL FACT CARD. FACT CARD MEASURES 9quot X 12quot. PATCH...
pin asus lenovo battery 2 bios lot hp toshiba ibm dell cmos acer laptop 10x. LOT 10X Laptop BIOS CMOS Battery for Lenovo Acer HP Dell Asus Toshiba IBM 2PinItem FeaturesGreat Part to replace the broken and non working CMOS Battery for Lenovo Acer HP Dell Asus Toshiba IBM This CMOS Ba...
Car Sound Exhaust Specializes In Superior Catalytic Converter And Performance Exhaust Technology And Has Been Doing So For The Past 35+ Years, Earning Its Reputation As An International Market Leader.
Sold by championconverter in Tonawanda...
Inner Corset. 100% Silk, 100% Leather.
Sold by 1stclassvoyager in Montgomery...
whitefriars stem ruby glass mid teardrop century 9485 british vase red vintage. Presenting an exquisite 1960s vintage ruby red art glass stem vase created by the quality art glass makers Whitefriars of England. This impressive piece model number 9485 has been hand crafted in an amazingly ri...
One Print Is Titled "aloha Tower" And The Other " Hong King Evening".
Sold by atlas_showroom in Plainview...
Purchases Made Are Subject To The Provisions Of Legislative Decree N. 185 Of 22-05-1999, Dictated In The Matter Of Distance Contracts, In The Event That The Delivery Of The Goods Takes Place At The Buyer's Home, As These Purchases Are Completed Outside The Business Premises. We Guarantee All The Products Purchased, Therefore At The Time Of Delivery Of The Ordered Goods Do Not Forget To Check These Simple Things Number Of Packages Delivered Corresponding To The Transport Document That The Packaging Is Intact Upon Collection Any Damage Or Lack Of Packages Must Be Immediately Communicated To The Courier The Customer Can Therefore Exercise The Right Of Withdrawal By Returning The Goods And Obtaining A Refund For Such Material. What To Do To Make Use Of The Right Of Withdrawal - To Obtain A R.
Sold by newgardenstore in Hilliard...
Victorian 18k Gold Hand Painted Portrait Pendant Brooch. Sapphire Ruby Pearls. Under The 18k Gold Back Cover, There Is What We Believe Is A Silk Woven Mat Under The Portrait. The Back Of The Piece Along With Hand Engraved Cut-out Cover Is 18k Yellow Gold.
Sold by saltymermaidventures in Fort Lauderdale...
Copyright ©2023. | All Rights Reserved. | Contact | Privacy Policy